McDonnell Genome Institute

Washington University

Transcript

lnc-TGIF1-16:1

Chromosome

chr18

Gene Name

lnc-TGIF1-16

Start

4459229

CPC Label

noncoding

End

4459458

Cancer

HCC

Strand

+

Peptide

GEHALTSGTIK

Modified Peptide

n[230]GEHALTSGTIK

Peptide Length

11

ORF Length

60

Open Reading Frame (ORF)

MYVKLISSDGHEFIVKGEHALTSGTIKAMLSGPGQFAENETNEVNFREIPSNVISKVCMY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0258358

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.429201114