McDonnell Genome Institute

Washington University

Transcript

lnc-TGIF1-10:1

Chromosome

chr18

Gene Name

lnc-TGIF1-10

Start

3653113

CPC Label

noncoding

End

3655990

Cancer

OV

Strand

+

Peptide

DALDQALLK

Modified Peptide

n[145]DALDQALLK

Peptide Length

9

ORF Length

81

Open Reading Frame (ORF)

LLTYFLGKHVCSVGIKDALDQALLKDPGQRFLTRLCPASNKATEEPRLADEHRLRGSHIRRQKQTCWCCPLRSVQMPLEEG

Conservation Score

0.531

PhyloCSF Frame 1

-2.035

No. of Spectra

19

CPC Coding Probability

0.0414322

PhyloCSF Frame 2 

-1.026

CNTI Index

noncoding

Max Probability

0.9541

PhyloCSF Frame 3

-2.71

CNTI Score

-0.36837693