McDonnell Genome Institute

Washington University

Transcript

lnc-TGFBRAP1-2:1

Chromosome

chr2

Gene Name

lnc-TGFBRAP1-2

Start

105193847

CPC Label

noncoding

End

105197404

Cancer

OV

Strand

-

Peptide

LLEVQTSQPK

Modified Peptide

n[145]LLEVQTSQPK

Peptide Length

10

ORF Length

54

Open Reading Frame (ORF)

LLEVQTSQPKVKHMLSQPSKINQHLHLSPASKGLPEDPTGTRTLRHSNSSTTKF

Conservation Score

1

PhyloCSF Frame 1

-5.779

No. of Spectra

44

CPC Coding Probability

0.412383

PhyloCSF Frame 2 

-3.462

CNTI Index

noncoding

Max Probability

0.9873

PhyloCSF Frame 3

-4.669

CNTI Score

-0.367503209