McDonnell Genome Institute

Washington University

Transcript

lnc-TGFB3-5:1

Chromosome

chr14

Gene Name

lnc-TGFB3-5

Start

75838156

CPC Label

noncoding

End

75839114

Cancer

OV

Strand

-

Peptide

ESEIIDISGDTLSQVR

Modified Peptide

n[145]ESEIIDISGDTLSQVR

Peptide Length

16

ORF Length

41

Open Reading Frame (ORF)

LGCLDKNMKIKSLEQISLFSLPIKESEIIDISGDTLSQVRF

Conservation Score

1

PhyloCSF Frame 1

-5.025

No. of Spectra

2

CPC Coding Probability

0.133467

PhyloCSF Frame 2 

-4.276

CNTI Index

noncoding

Max Probability

0.9354

PhyloCSF Frame 3

-5.745

CNTI Score

-0.294466743