McDonnell Genome Institute

Washington University

Transcript

lnc-TGFA-2:1

Chromosome

chr2

Gene Name

lnc-TGFA-2

Start

70656783

CPC Label

noncoding

End

70658325

Cancer

BRCA-Luminal B

Strand

-

Peptide

AEWPHLK

Modified Peptide

n[145]AEWPHLK

Peptide Length

7

ORF Length

44

Open Reading Frame (ORF)

MAIGPRAEWPHLKHIIKWEYISGNPTPTLPLHLTPVGPALWVID

Conservation Score

0.427

PhyloCSF Frame 1

-3.632

No. of Spectra

5

CPC Coding Probability

0.106461

PhyloCSF Frame 2 

-3.476

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

-5.508

CNTI Score

-0.395552015