McDonnell Genome Institute

Washington University

Transcript

lnc-TGFA-1:1

Chromosome

chr2

Gene Name

lnc-TGFA-1

Start

70401994

CPC Label

noncoding

End

70403798

Cancer

OV

Strand

-

Peptide

LLQLLCGMGVK

Modified Peptide

n[145]LLQLLCGMGVK

Peptide Length

11

ORF Length

112

Open Reading Frame (ORF)

LLQLLCGMGVKFPGQSSCVPRRIMAASAESCRLSGKWGKASSHRPHPAPMQSKGPFSLPPCPLSATALSLFSDSGQAGLRTCPMLPTFQLQKKRALVLPAPVESTCRICALP

Conservation Score

0.462

PhyloCSF Frame 1

0

No. of Spectra

40

CPC Coding Probability

0.232594

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9785

PhyloCSF Frame 3

0

CNTI Score

-0.363772342