McDonnell Genome Institute

Washington University

Transcript

lnc-TFEC-2:4

Chromosome

chr7

Gene Name

lnc-TFEC-2

Start

116238003

CPC Label

noncoding

End

116327896

Cancer

CCRC

Strand

-

Peptide

LSITDVK

Modified Peptide

n[230]LSITDVK

Peptide Length

7

ORF Length

74

Open Reading Frame (ORF)

MLSITDVKELMTPVVMSSLQECPMNLTDVNSGGNYGVLVTTQRQSTSCCHHVKKDVFASSFATIVSFLRTSQPC

Conservation Score

0.531

PhyloCSF Frame 1

0

No. of Spectra

30

CPC Coding Probability

0.0514912

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.320150291