McDonnell Genome Institute

Washington University

Transcript

lnc-TFDP2-8:1

Chromosome

chr3

Gene Name

lnc-TFDP2-8

Start

141865011

CPC Label

noncoding

End

141865279

Cancer

PRAD

Strand

-

Peptide

ADAGEEGNNPAENGVAK

Modified Peptide

‚Äč

Peptide Length

17

ORF Length

89

Open Reading Frame (ORF)

MPKRKAEGDTKRDKAKVKDEPQRRSVRLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGEEGNNPAENGVAKTDQAQKAESPGDA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.127696

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9107

PhyloCSF Frame 3

0

CNTI Score

-0.308807847