McDonnell Genome Institute

Washington University

Transcript

lnc-TFDP2-11:1

Chromosome

chr3

Gene Name

lnc-TFDP2-11

Start

141306067

CPC Label

noncoding

End

141311692

Cancer

EOGC

Strand

-

Peptide

AGSSFLK

Modified Peptide

n[145]AGSSFLK

Peptide Length

7

ORF Length

70

Open Reading Frame (ORF)

MLGSELGGSQPATHQEKDLPSLVVRGMPAKAPGNGGREGNWGGDAGVWGNQYHTCLPRSKAGSSFLKLRH

Conservation Score

0.175

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.139478

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

0.661966086