McDonnell Genome Institute

Washington University

Transcript

lnc-TFCP2L1-7:2

Chromosome

chr2

Gene Name

lnc-TFCP2L1-7

Start

120902275

CPC Label

noncoding

End

120911781

Cancer

OV

Strand

-

Peptide

EMGPTAPAMAGR

Modified Peptide

n[145]EMGPTAPAM[147]AGR

Peptide Length

12

ORF Length

64

Open Reading Frame (ORF)

MPQGDQGWDMTAKRRKPQHRKTEGTQREMGPTAPAMAGRRLTPPPAGPTRRSCSYGFSHRSLME

Conservation Score

0.067

PhyloCSF Frame 1

-4.265

No. of Spectra

3

CPC Coding Probability

0.240185

PhyloCSF Frame 2 

-4.634

CNTI Index

noncoding

Max Probability

0.8212

PhyloCSF Frame 3

-4.472

CNTI Score

-0.312966591