McDonnell Genome Institute

Washington University

Transcript

lnc-TFCP2L1-7:1

Chromosome

chr2

Gene Name

lnc-TFCP2L1-7

Start

120902275

CPC Label

noncoding

End

120911781

Cancer

OV

Strand

-

Peptide

LSFLAHVK

Modified Peptide

n[145]LSFLAHVK

Peptide Length

8

ORF Length

71

Open Reading Frame (ORF)

LSFLAHVKSPQSPARFISSWSSSLWILGEEHIWAQQERGAEQQQPRAGSTKGFGKAACHLAVTTQMLLCVV

Conservation Score

0.036

PhyloCSF Frame 1

-4.982

No. of Spectra

1

CPC Coding Probability

0.0839803

PhyloCSF Frame 2 

-5.24

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-4.924

CNTI Score

-0.312966591