McDonnell Genome Institute

Washington University

Transcript

lnc-TFCP2L1-1:2

Chromosome

chr2

Gene Name

lnc-TFCP2L1-1

Start

121137741

CPC Label

noncoding

End

121183774

Cancer

OV

Strand

-

Peptide

LSPWYNGETGAK

Modified Peptide

n[145]LSPWYNGETGAK

Peptide Length

12

ORF Length

59

Open Reading Frame (ORF)

LLTGWLVGGGRFCRNSVPLYVPSLWQELGIKLSPWYNGETGAKKKINRERLAVGSHFRR

Conservation Score

0.091

PhyloCSF Frame 1

-4.749

No. of Spectra

1

CPC Coding Probability

0.0180146

PhyloCSF Frame 2 

-1.879

CNTI Index

noncoding

Max Probability

0.6057

PhyloCSF Frame 3

-4.83

CNTI Score

-0.361197803