McDonnell Genome Institute

Washington University

Transcript

lnc-TFCP2-4:1

Chromosome

chr12

Gene Name

lnc-TFCP2-4

Start

51198639

CPC Label

noncoding

End

51217667

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

VLEVGVDAQLPAEEESK

Modified Peptide

n[145]VLEVGVDAQLPAEEESK

Peptide Length

17

ORF Length

97

Open Reading Frame (ORF)

MDPGAGSETSLTVNEQVIVMSGHETIRVLEVGVDAQLPAEEESKGLEGVAAEGSQSGDPAEASQAAGEAGPDNLGSSAEATVLQVKWLVSRGWPCGQ

Conservation Score

1

PhyloCSF Frame 1

9.914

No. of Spectra

2

CPC Coding Probability

0.0903965

PhyloCSF Frame 2 

1.923

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

5.313

CNTI Score

-0.287072297