McDonnell Genome Institute

Washington University

Transcript

lnc-TFB1M-2:1

Chromosome

chr6

Gene Name

lnc-TFB1M-2

Start

155326844

CPC Label

noncoding

End

155328708

Cancer

BRCA-Basal-like

Strand

-

Peptide

LCFSLNITFSRDRGGR

Modified Peptide

n[145]LCFSLNITFSRDRGGR

Peptide Length

16

ORF Length

56

Open Reading Frame (ORF)

MPSGALVGKLCFSLNITFSRDRGGRHYDQRTFILCIPPNARLFPEKWPSTQCRGNG

Conservation Score

0.411

PhyloCSF Frame 1

-3.2

No. of Spectra

1

CPC Coding Probability

0.10269

PhyloCSF Frame 2 

-4.038

CNTI Index

noncoding

Max Probability

0.995

PhyloCSF Frame 3

-4.727

CNTI Score

-0.376849125