McDonnell Genome Institute

Washington University

Transcript

lnc-TFB1M-1:1

Chromosome

chr6

Gene Name

lnc-TFB1M-1

Start

155253138

CPC Label

noncoding

End

155256724

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

SYIWTMSAGRK

Modified Peptide

n[145]SYIWTMSAGRK

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

MHILVEETKSYIWTMSAGRKTRDWGLGVAVFYSRTSGSKRHV

Conservation Score

0.023

PhyloCSF Frame 1

-4.062

No. of Spectra

3

CPC Coding Probability

0.271922

PhyloCSF Frame 2 

-5.108

CNTI Index

noncoding

Max Probability

0.91

PhyloCSF Frame 3

-2.288

CNTI Score

-0.351707274