McDonnell Genome Institute

Washington University

Transcript

lnc-TFAP4-3:7

Chromosome

chr16

Gene Name

lnc-TFAP4-3

Start

4277992

CPC Label

noncoding

End

4307587

Cancer

HCC

Strand

-

Peptide

HSLPPSSR

Modified Peptide

n[230]HSLPPSSR

Peptide Length

8

ORF Length

106

Open Reading Frame (ORF)

MDKALALCLVPLTSLVGAYASLRCLCKGRRTPRPVEGAAALRHSLPPSSRRLIYPFIREASCASAFPRWGRVKSRPGLCGWDTPRDLPVLLLGSPGPTLPLPHLPT

Conservation Score

0.863

PhyloCSF Frame 1

0

No. of Spectra

27

CPC Coding Probability

0.277204

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

0

CNTI Score

-0.263962086