McDonnell Genome Institute

Washington University

Transcript

lnc-TFAP2A-7:1

Chromosome

chr6

Gene Name

lnc-TFAP2A-7

Start

10531125

CPC Label

noncoding

End

10534162

Cancer

OV

Strand

-

Peptide

DGIDLATIETLLK

Modified Peptide

n[145]DGIDLATIETLLK

Peptide Length

13

ORF Length

42

Open Reading Frame (ORF)

LDQRRDGIDLATIETLLKVNLKRTSGLGDLVYNWCICLLAVG

Conservation Score

0.196

PhyloCSF Frame 1

-5.271

No. of Spectra

41

CPC Coding Probability

0.00355894

PhyloCSF Frame 2 

-3.599

CNTI Index

noncoding

Max Probability

0.9911

PhyloCSF Frame 3

-4.7

CNTI Score

-0.458026901