McDonnell Genome Institute

Washington University

Transcript

lnc-TFAP2A-5:1

Chromosome

chr6

Gene Name

lnc-TFAP2A-5

Start

10365592

CPC Label

noncoding

End

10366582

Cancer

EOGC

Strand

-

Peptide

LEFFLHDSWWQK

Modified Peptide

n[145]LEFFLHDSWWQK

Peptide Length

12

ORF Length

64

Open Reading Frame (ORF)

LEFFLHDSWWQKRDKVHLRQLEVKPHALELPDKHSLAFLLAFVILLERINGVSYLCREPLQDFT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0479602

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.612

PhyloCSF Frame 3

0

CNTI Score

0.648179285