McDonnell Genome Institute

Washington University

Transcript

lnc-TF-3:2

Chromosome

chr3

Gene Name

lnc-TF-3

Start

133661998

CPC Label

noncoding

End

133700242

Cancer

OV

Strand

+

Peptide

LGDSEMNLAK

Modified Peptide

n[145]LGDSEM[147]NLAK

Peptide Length

10

ORF Length

49

Open Reading Frame (ORF)

LGDSEMNLAKTCLESFTDECGRHTSMDSYLMELDYLMDMDGVLYGGQRD

Conservation Score

0.668

PhyloCSF Frame 1

-2.443

No. of Spectra

2

CPC Coding Probability

0.0702497

PhyloCSF Frame 2 

-3.867

CNTI Index

noncoding

Max Probability

0.9861

PhyloCSF Frame 3

-3.959

CNTI Score

-0.362992454