McDonnell Genome Institute

Washington University

Transcript

lnc-TF-12:1

Chromosome

chr3

Gene Name

lnc-TF-12

Start

133784777

CPC Label

noncoding

End

133796640

Cancer

PRAD

Strand

+

Peptide

EGGGGGQPPCPASGPVR

Modified Peptide

EGGGGGQPPCPASGPVR

Peptide Length

17

ORF Length

179

Open Reading Frame (ORF)

LPGRPYWEVRSPSARPAAPSGREVGGSAPRPTSRPIREGGGGVSPPPGQPPCPGGRWGCQPHARPAASSGREVGGSAPRPASRPVREGGGGGQPPCPASGPVREVRGASARLPLLGSEEPLCPASRPSGRESGGSAPPRPASRPVREVRGASAQPPPGLGGVPNSSLRTGQDDNGGLVE

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.134318

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.2223

PhyloCSF Frame 3

0

CNTI Score

0.707647279