McDonnell Genome Institute

Washington University

Transcript

lnc-TEX35-4:1

Chromosome

chr1

Gene Name

lnc-TEX35-4

Start

178598803

CPC Label

noncoding

End

178600284

Cancer

OV

Strand

+

Peptide

AAHNMATGFNR

Modified Peptide

n[145]AAHNMATGFNR

Peptide Length

11

ORF Length

46

Open Reading Frame (ORF)

LEASLSFSISGSLHRAAHNMATGFNRASKRHFCFLVLQSLEDATAP

Conservation Score

0.121

PhyloCSF Frame 1

-4.095

No. of Spectra

7

CPC Coding Probability

0.0215768

PhyloCSF Frame 2 

-4.513

CNTI Index

noncoding

Max Probability

0.8532

PhyloCSF Frame 3

-5.34

CNTI Score

-0.39179977