McDonnell Genome Institute

Washington University

Transcript

lnc-TEX35-1:2

Chromosome

chr1

Gene Name

lnc-TEX35-1

Start

178542795

CPC Label

noncoding

End

178548889

Cancer

OV

Strand

+

Peptide

LGAGAAFSMR

Modified Peptide

n[145]LGAGAAFSM[147]R

Peptide Length

10

ORF Length

52

Open Reading Frame (ORF)

LVLLKPIIISCPKPKNKLYKHQHYIGQDLAHRLGAGAAFSMRRMNRPSGRCL

Conservation Score

0.648

PhyloCSF Frame 1

-4.565

No. of Spectra

1

CPC Coding Probability

0.242921

PhyloCSF Frame 2 

-4.133

CNTI Index

noncoding

Max Probability

0.3265

PhyloCSF Frame 3

-5.553

CNTI Score

-0.362908914