McDonnell Genome Institute

Washington University

Transcript

lnc-TEX29-4:1

Chromosome

chr13

Gene Name

lnc-TEX29-4

Start

111368480

CPC Label

noncoding

End

111371727

Cancer

HCC

Strand

+

Peptide

VFHVTLGIVIK

Modified Peptide

n[272]VFHVTLGIVIK

Peptide Length

11

ORF Length

41

Open Reading Frame (ORF)

MVFHVTLGIVIKWAILGSLIQKVSAFSYKSFSPLNHFRISC

Conservation Score

0.397

PhyloCSF Frame 1

0

No. of Spectra

58

CPC Coding Probability

0.0605012

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.384697162