McDonnell Genome Institute

Washington University

Transcript

lnc-TEX264-2:1

Chromosome

chr3

Gene Name

lnc-TEX264-2

Start

51640507

CPC Label

noncoding

End

51641023

Cancer

OSCC

Strand

+

Peptide

MWMTLLPLYAR

Modified Peptide

n[145]M[147]WM[147]TLLPLYAR

Peptide Length

11

ORF Length

33

Open Reading Frame (ORF)

MWMTLLPLYARKDTLGCSWYSYLFLFLFLFLFF

Conservation Score

0.582

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.00745803

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.734

PhyloCSF Frame 3

0

CNTI Score

-0.467168788