McDonnell Genome Institute

Washington University

Transcript

lnc-TEX22-4:1

Chromosome

chr14

Gene Name

lnc-TEX22-4

Start

105348976

CPC Label

coding

End

105349673

Cancer

OV

Strand

+

Peptide

AAMTLAAWPLPSGPDR

Modified Peptide

n[145]AAM[147]TLAAWPLPSGPDR

Peptide Length

16

ORF Length

121

Open Reading Frame (ORF)

MLVSSPCLAQAPPPPWGRAAMTLAAWPLPSGPDREVSPPTVRATPALSGSYGSRCVACIGPRGLSGCCAPDPSPSAPRGWGPALGAHVQGPTQVPAAGRILDTCCGSDTGSPGLPDLQSST

Conservation Score

0.402

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.725203

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4138

PhyloCSF Frame 3

0

CNTI Score

-0.294192722