McDonnell Genome Institute

Washington University

Transcript

lnc-TEX19-2:1

Chromosome

chr17

Gene Name

lnc-TEX19-2

Start

82229044

CPC Label

coding

End

82231926

Cancer

OV

Strand

+

Peptide

GATSGSALSPPPRPLCPSGPGAPGAWTSLLDPER

Modified Peptide

n[145]GATSGSALSPPPRPLCPSGPGAPGAWTSLLDPER

Peptide Length

34

ORF Length

108

Open Reading Frame (ORF)

MLARGPGPRSSPVPGKGATSGSALSPPPRPLCPSGPGAPGAWTSLLDPERAPPRAPESQPRPSAPSHTWLPSLVSPGPARRPPVGLPSGAGLGPGDGCAGGQARSGYK

Conservation Score

0.604

PhyloCSF Frame 1

-1.542

No. of Spectra

5

CPC Coding Probability

0.933772

PhyloCSF Frame 2 

-3.322

CNTI Index

noncoding

Max Probability

0.9107

PhyloCSF Frame 3

-2.722

CNTI Score

-0.234977663