McDonnell Genome Institute

Washington University

Transcript

lnc-TEX15-1:1

Chromosome

chr8

Gene Name

lnc-TEX15-1

Start

30867296

CPC Label

noncoding

End

30913036

Cancer

CCRC

Strand

-

Peptide

GQRCVKVEDIAGNLK

Modified Peptide

n[230]GQRCVKVEDIAGNLK

Peptide Length

15

ORF Length

121

Open Reading Frame (ORF)

MEMKETAKQDTLWQMSSTSKPVLNTREVNPLKKFTIPKIRRTAEKVYLSPCYTNSREYSFIHDTLNQCRLDVNCDLQSLWQFGDTKLVHNEELEKNFTAKRGQRCVKVEDIAGNLKNSSAF

Conservation Score

1

PhyloCSF Frame 1

-4.716

No. of Spectra

1

CPC Coding Probability

0.171872

PhyloCSF Frame 2 

7.777

CNTI Index

noncoding

Max Probability

0.0647

PhyloCSF Frame 3

-1.724

CNTI Score

-0.307327246