McDonnell Genome Institute

Washington University

Transcript

lnc-TEX14-2:1

Chromosome

chr17

Gene Name

lnc-TEX14-2

Start

58748237

CPC Label

noncoding

End

58754415

Cancer

OV

Strand

-

Peptide

HSDSFSTLK

Modified Peptide

n[145]HSDSFSTLK

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

LPCPWQHIIQQKHSDSFSTLKNMFSQIIHPILSMYCFWVSVGFRV

Conservation Score

1

PhyloCSF Frame 1

-4.748

No. of Spectra

4

CPC Coding Probability

0.0398065

PhyloCSF Frame 2 

-5.94

CNTI Index

noncoding

Max Probability

0.9932

PhyloCSF Frame 3

-1.762

CNTI Score

-0.428590142