McDonnell Genome Institute

Washington University

Transcript

lnc-TET2-3:1

Chromosome

chr4

Gene Name

lnc-TET2-3

Start

104556959

CPC Label

noncoding

End

104568877

Cancer

BRCA-Basal-like

Strand

+

Peptide

VLLLLPRLECK

Modified Peptide

n[145]VLLLLPRLECK

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

LELSCMRVLLLLPRLECKGTISAHCNLCFLSSSDPPASAS

Conservation Score

0.199

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0900518

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7358

PhyloCSF Frame 3

0

CNTI Score

-0.364907638