McDonnell Genome Institute

Washington University

Transcript

lnc-TESPA1-2:2

Chromosome

chr12

Gene Name

lnc-TESPA1-2

Start

54900816

CPC Label

noncoding

End

54901088

Cancer

BRCA-Luminal A

Strand

-

Peptide

LSAPCLQRWSLQR

Modified Peptide

n[145]LSAPCLQRWSLQR

Peptide Length

13

ORF Length

56

Open Reading Frame (ORF)

LSAPCLQRWSLQRQAGLLELWWAPPSSSFPATLFTYSSLSNGRPPSLSLAATLQFD

Conservation Score

0.136

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00518779

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

0

CNTI Score

-0.340468851