McDonnell Genome Institute

Washington University

Transcript

lnc-TESC-3:1

Chromosome

chr12

Gene Name

lnc-TESC-3

Start

117031149

CPC Label

noncoding

End

117032846

Cancer

CCRC

Strand

-

Peptide

VVVITGTR

Modified Peptide

n[230]VVVITGTR

Peptide Length

8

ORF Length

119

Open Reading Frame (ORF)

LPFLFLRRSLALSPRLECSGAISAHCNLCLLAASDSPASASRVVVITGTRHQAWLIFVFLVEMGFCHVGQAGLELLTSGDTPASVSQSAGITGLSHLAQPKLVSLYLILLKVVVSKKTY

Conservation Score

0.063

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0918273

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

0

CNTI Score

-0.347165826