McDonnell Genome Institute

Washington University

Transcript

lnc-TESC-1:1

Chromosome

chr12

Gene Name

lnc-TESC-1

Start

116977441

CPC Label

noncoding

End

116987337

Cancer

OV

Strand

-

Peptide

AGGSVNIR

Modified Peptide

n[145]AGGSVNIR

Peptide Length

8

ORF Length

111

Open Reading Frame (ORF)

MKIHSVKGQRCPDHMPKSSKPASRTRSRRAGGSVNIRGTLLILGPSSASCGSITKDSRTRLISQTWEHCHCHSGAYMDKTKLAWLFGPGVPFPRILRAFCGNLSLKVKNNS

Conservation Score

1

PhyloCSF Frame 1

-2.687

No. of Spectra

1

CPC Coding Probability

0.110477

PhyloCSF Frame 2 

-3.303

CNTI Index

noncoding

Max Probability

0.2183

PhyloCSF Frame 3

-3.661

CNTI Score

-0.332091253