McDonnell Genome Institute

Washington University

Transcript

lnc-TES-1:1

Chromosome

chr7

Gene Name

lnc-TES-1

Start

115789728

CPC Label

noncoding

End

115791049

Cancer

BRCA-Luminal B

Strand

+

Peptide

SFHIAGK

Modified Peptide

n[145]SFHIAGK

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

LTQQEGESGICVESKMLMFGCAEKSFHIAGKALFPFSPACKE

Conservation Score

0.407

PhyloCSF Frame 1

-4.947

No. of Spectra

41

CPC Coding Probability

0.0359152

PhyloCSF Frame 2 

-4.943

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-4.045

CNTI Score

-0.307696675