McDonnell Genome Institute

Washington University

Transcript

lnc-TENM4-8:4

Chromosome

chr11

Gene Name

lnc-TENM4-8

Start

79975074

CPC Label

noncoding

End

80083673

Cancer

OV

Strand

-

Peptide

ARLMPDYLITEAK

Modified Peptide

n[145]ARLM[147]PDYLITEAK

Peptide Length

13

ORF Length

48

Open Reading Frame (ORF)

LLGFSPFAPATFPGTKLLSPTVGRARLMPDYLITEAKTIAAIHDANIF

Conservation Score

1

PhyloCSF Frame 1

-5.423

No. of Spectra

4

CPC Coding Probability

0.0416676

PhyloCSF Frame 2 

-3.543

CNTI Index

noncoding

Max Probability

0.6898

PhyloCSF Frame 3

-4.901

CNTI Score

-0.365142817