McDonnell Genome Institute

Washington University

Transcript

lnc-TENM4-4:6

Chromosome

chr11

Gene Name

lnc-TENM4-4

Start

80746165

CPC Label

noncoding

End

80762777

Cancer

OV

Strand

-

Peptide

LAETALLGSTR

Modified Peptide

n[145]LAETALLGSTR

Peptide Length

11

ORF Length

75

Open Reading Frame (ORF)

LAETALLGSTRHLGRHSTGTCRIRFQCGSPTWPGVQTRTSCFSPHGFLQGLLGLLQSMPAGFRDIKRSVAHTCYS

Conservation Score

0.007

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0258626

PhyloCSF Frame 2 

-5.965

CNTI Index

noncoding

Max Probability

0.9297

PhyloCSF Frame 3

-5.106

CNTI Score

-0.392881204