McDonnell Genome Institute

Washington University

Transcript

lnc-TENM3-3:3

Chromosome

chr4

Gene Name

lnc-TENM3-3

Start

180058940

CPC Label

noncoding

End

180282181

Cancer

OV

Strand

+

Peptide

VCTNELNVITLIMEK

Modified Peptide

n[145]VCTNELNVITLIMEK

Peptide Length

15

ORF Length

35

Open Reading Frame (ORF)

MLKVCTNELNVITLIMEKSILVNYYFRKSICTSIV

Conservation Score

0.449

PhyloCSF Frame 1

-5.352

No. of Spectra

7

CPC Coding Probability

0.107143

PhyloCSF Frame 2 

-5.958

CNTI Index

coding

Max Probability

0.9002

PhyloCSF Frame 3

-6.373

CNTI Score

0.632615625