McDonnell Genome Institute

Washington University

Transcript

lnc-TENM3-3:2

Chromosome

chr4

Gene Name

lnc-TENM3-3

Start

180058940

CPC Label

noncoding

End

180250169

Cancer

CCRC

Strand

+

Peptide

VLPNVILTK

Modified Peptide

VLPNVILTK

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LSTYWVQGTVMCVSRVLPNVILTKTISGGCGNYHDAHFANEEAEPLKCSTNVPPGYTG

Conservation Score

0.048

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0309835

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9963

PhyloCSF Frame 3

0

CNTI Score

0.622297255