McDonnell Genome Institute

Washington University

Transcript

lnc-TENM1-3:1

Chromosome

chrX

Gene Name

lnc-TENM1-3

Start

124173000

CPC Label

noncoding

End

124174459

Cancer

OSCC

Strand

-

Peptide

AGSSTLK

Modified Peptide

n[145]AGSSTLK

Peptide Length

7

ORF Length

121

Open Reading Frame (ORF)

LHLYFTQDFVQKYWAWWSLQQTSWNVPLVKVASLGCGHGKEDEETPSEQNVSVGVSQFKAGSSTLKTQPREIYVPFLKDILPLANLPGREPYLVGARANQYQHQKHHSAKKSLKRDMDRAS

Conservation Score

0.826

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.230023

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1386

PhyloCSF Frame 3

0

CNTI Score

-0.370127943