McDonnell Genome Institute

Washington University

Transcript

lnc-TEN1-1:1

Chromosome

chr17

Gene Name

lnc-TEN1-1

Start

75943831

CPC Label

noncoding

End

75945142

Cancer

OV

Strand

+

Peptide

LGQMLWLTPIISALWEVLGQR

Modified Peptide

n[145]LGQMLWLTPIISALWEVLGQR

Peptide Length

21

ORF Length

38

Open Reading Frame (ORF)

LGQMLWLTPIISALWEVLGQRGLCRSMISSNLQRHPIY

Conservation Score

0.209

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0583542

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2318

PhyloCSF Frame 3

0

CNTI Score

-0.564570619