McDonnell Genome Institute

Washington University

Transcript

lnc-TEKT4-3:1

Chromosome

chr2

Gene Name

lnc-TEKT4-3

Start

94912431

CPC Label

noncoding

End

94912831

Cancer

OV

Strand

+

Peptide

TTGFGMIYNSLDYAK

Modified Peptide

n[145]TTGFGMIYNSLDYAK

Peptide Length

15

ORF Length

94

Open Reading Frame (ORF)

MTNRLLPRKQMLTDVLHLGKATVPKTEIRGKLAKMYKTTPDVISVFGFRTNFGGSKTTGFGMIYNSLDYAKKNEPKHRLARHGLYEKKKTSRRQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.183851

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.39654176