McDonnell Genome Institute

Washington University

Transcript

lnc-TEKT3-1:1

Chromosome

chr17

Gene Name

lnc-TEKT3-1

Start

15240426

CPC Label

noncoding

End

15244396

Cancer

BRCA-Luminal B

Strand

-

Peptide

AVPAPSILWHLEDK

Modified Peptide

n[145]AVPAPSILWHLEDK

Peptide Length

14

ORF Length

43

Open Reading Frame (ORF)

MRAVPAPSILWHLEDKTEAKCRFLPWASLYSVELRLFLLSSLK

Conservation Score

0.02

PhyloCSF Frame 1

-5.298

No. of Spectra

20

CPC Coding Probability

0.0824089

PhyloCSF Frame 2 

-5.34

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-6.142

CNTI Score

-0.430214722