McDonnell Genome Institute

Washington University

Transcript

lnc-TEK-2:1

Chromosome

chr9

Gene Name

lnc-TEK-2

Start

27245473

CPC Label

noncoding

End

27246284

Cancer

PRAD

Strand

+

Peptide

LCISFPGR

Modified Peptide

LCISFPGR

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

LCISFPGRYEKKVEGSPKQDICLEARNVEWLKKEKKK

Conservation Score

0.627

PhyloCSF Frame 1

-5.669

No. of Spectra

1

CPC Coding Probability

0.0162382

PhyloCSF Frame 2 

-4.562

CNTI Index

noncoding

Max Probability

0.9935

PhyloCSF Frame 3

-5.739

CNTI Score

-0.411760495