McDonnell Genome Institute

Washington University

Transcript

lnc-TEFM-8:1

Chromosome

chr17

Gene Name

lnc-TEFM-8

Start

31007342

CPC Label

noncoding

End

31009315

Cancer

OV

Strand

-

Peptide

NLLSVTYK

Modified Peptide

n[145]NLLSVTYK

Peptide Length

8

ORF Length

131

Open Reading Frame (ORF)

LGCTTRRQPAARASAASSRPLRPFPPLVWARPSSRRRWSAEAGGAPAAPEQDSRLLLLHPPFCLRDPGFCFSLIEMVESVKKLAGMDVELTAEERNLLSVTYKNVIGARRASWRIISSLEQKEGTREEKTS

Conservation Score

1

PhyloCSF Frame 1

0.108

No. of Spectra

4

CPC Coding Probability

0.365403

PhyloCSF Frame 2 

0.874

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-1.17

CNTI Score

-0.277732051