McDonnell Genome Institute

Washington University

Transcript

lnc-TECRL-10:1

Chromosome

chr4

Gene Name

lnc-TECRL-10

Start

64611373

CPC Label

noncoding

End

64611888

Cancer

PRAD

Strand

-

Peptide

LTPNRHYSSKPPR

Modified Peptide

Peptide Length

13

ORF Length

121

Open Reading Frame (ORF)

LTPNRHYSSKPPRSTTPEHICIAHIRSFNYLSPSQSNRKQVIQALLITIILGIYFTLLQISEYFEAHFIISDRVYGSTFFIVTGFHGFHVIIGSTFLTTCLIRQLLCHFTSNHHFGFEATT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0163957

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.692

PhyloCSF Frame 3

0

CNTI Score

-0.370186258