McDonnell Genome Institute

Washington University

Transcript

lnc-TECRL-1:2

Chromosome

chr4

Gene Name

lnc-TECRL-1

Start

63462506

CPC Label

noncoding

End

63474133

Cancer

OV

Strand

-

Peptide

KVECGDGENTEVQK

Modified Peptide

n[145]KVECGDGENTEVQK

Peptide Length

14

ORF Length

86

Open Reading Frame (ORF)

MNGLTTGRPALLQMLKKVLPRKKKGNLMETCVYQMERRAMGILTTSVRKKVECGDGENTEVQKKRRQEATHGSSFSHKSRNATDYK

Conservation Score

0.094

PhyloCSF Frame 1

-5.516

No. of Spectra

4

CPC Coding Probability

0.0642349

PhyloCSF Frame 2 

-5.108

CNTI Index

noncoding

Max Probability

0.6881

PhyloCSF Frame 3

-4.229

CNTI Score

-0.366809789