McDonnell Genome Institute

Washington University

Transcript

lnc-TECRL-1:1

Chromosome

chr4

Gene Name

lnc-TECRL-1

Start

63468700

CPC Label

noncoding

End

63494278

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

VDTVIHK

Modified Peptide

n[145]VDTVIHK

Peptide Length

7

ORF Length

56

Open Reading Frame (ORF)

LKVDTVIHKMNGLTTGRPALLQMLKKVLPRKKKGNLMETCVYQMERRAMGILTTVH

Conservation Score

0.094

PhyloCSF Frame 1

-5.516

No. of Spectra

1

CPC Coding Probability

0.0249742

PhyloCSF Frame 2 

-5.108

CNTI Index

noncoding

Max Probability

0.0984

PhyloCSF Frame 3

-4.229

CNTI Score

-0.441588491