McDonnell Genome Institute

Washington University

Transcript

lnc-TECPR2-1:2

Chromosome

chr14

Gene Name

lnc-TECPR2-1

Start

102524926

CPC Label

coding

End

102529145

Cancer

OV

Strand

+

Peptide

FEKGSSVHPRTHPAWGSTERPAQPLHGMTK

Modified Peptide

n[145]FEKGSSVHPRTHPAWGSTERPAQPLHGM[147]TK

Peptide Length

30

ORF Length

80

Open Reading Frame (ORF)

MFEKGSSVHPRTHPAWGSTERPAQPLHGMTKSICSPGGSPWPELGQKYQARMALPSQSRRLRGQTGVLSSSARRTHSSPL

Conservation Score

0.308

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5556

PhyloCSF Frame 3

0

CNTI Score

-0.311761857