McDonnell Genome Institute

Washington University

Transcript

lnc-TEAD4-5:1

Chromosome

chr12

Gene Name

lnc-TEAD4-5

Start

3188978

CPC Label

noncoding

End

3195604

Cancer

OV

Strand

+

Peptide

AHISPVANQQR

Modified Peptide

n[145]AHISPVANQQR

Peptide Length

11

ORF Length

53

Open Reading Frame (ORF)

LSPVSCCQPEEFTERQRELGIYSKAHISPVANQQRCGMLISFIHFSSSPLRML

Conservation Score

1

PhyloCSF Frame 1

-5.242

No. of Spectra

2

CPC Coding Probability

0.0429308

PhyloCSF Frame 2 

-4.361

CNTI Index

noncoding

Max Probability

0.9939

PhyloCSF Frame 3

-2.768

CNTI Score

-0.333284268