McDonnell Genome Institute

Washington University

Transcript

lnc-TEAD4-1:1

Chromosome

chr12

Gene Name

lnc-TEAD4-1

Start

3041436

CPC Label

noncoding

End

3044950

Cancer

OV

Strand

+

Peptide

LSDLGASYFISLCLSFPICK

Modified Peptide

n[145]LSDLGASYFISLCLSFPICK

Peptide Length

20

ORF Length

35

Open Reading Frame (ORF)

LSDLGASYFISLCLSFPICKICITITYLAYLQCLA

Conservation Score

1

PhyloCSF Frame 1

-6.034

No. of Spectra

10

CPC Coding Probability

0.0900354

PhyloCSF Frame 2 

-4.12

CNTI Index

noncoding

Max Probability

0.9682

PhyloCSF Frame 3

-4.432

CNTI Score

-0.341863895