McDonnell Genome Institute

Washington University

Transcript

lnc-TDRP-1:1

Chromosome

chr8

Gene Name

lnc-TDRP-1

Start

725187

CPC Label

noncoding

End

725877

Cancer

PRAD

Strand

-

Peptide

KEGISLMEQGGLENPGK

Modified Peptide

Peptide Length

17

ORF Length

57

Open Reading Frame (ORF)

MNERRRGEKKEGISLMEQGGLENPGKGRGAVPARWLICKVGGSTVRTQPGDRSHARF

Conservation Score

0.86

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0352156

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9892

PhyloCSF Frame 3

0

CNTI Score

-0.37680615